3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
Catalog #: 101-10018
Human ACSL5 monoclonal antibody (100 ug)
| Size | 100 µg |
| Estimated Lead Time | 1-2 weeks |
| Species | Human |
| Host Species | Mouse |
| Accession Number | NP_057318 |
| Gene Id | 51703 |
| Gene Symbols | ACSL5 |
| Protein Name / Synonyms | ACS2, ACS5, FACL5 |
| Clonality | Monoclonal |
| Immunogen Sequence | PQPVLPLLDLNNQSVGIEGGARKGVSQKNNDLTSCCFSDA KTMYEVFQRGLAVSDNGPCLGYRKPNQPYRWLSYKQVSDR AEYLGSCLLHKGYKSS |
| Isotype | Kappa, IgG1 |
| Recommended Applications | Immunoprecipitation, Western Blotting, ELISA, IHC |
| Shipping Type | Blue ice |
| Storage | -20°C |
| More Information | Specificity Human |
![]() | Western Blot detection against Immunogen (36.3 KDa). |
![]() | ACSL5 monoclonal antibody Western Blot analysis of ACSL5 expression in HepG2 . |
![]() | Western Blot analysis of ACSL5 expression in transfected 293T cell line by ACSL5 monoclonal antibody. Lane 1: ACSL5 transfected lysate(82.3 KDa). Lane 2: Non-transfected lysate. |
![]() | Immunoperoxidase of monoclonal antibody to ACSL5 on formalin-fixed paraffin-embedded human colon. [antibody concentration 3 ug/ml] |
![]() | Immunoprecipitation of ACSL5 transfected lysate using anti-ACSL5 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with ACSL5 MaxPab rabbit polyclonal antibody. |
![]() | Detection limit for recombinant GST tagged ACSL5 is approximately 0.1ng/ml as a capture antibody. |
Your cart is empty.