3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
Catalog #: 101-10020
Human ACTRT2 monoclonal antibody (100 ug)
| Size | 100 µg |
| Estimated Lead Time | 1-2 weeks |
| Species | Human |
| Host Species | Mouse |
| Accession Number | NP_536356 |
| Gene Id | 140625 |
| Gene Symbols | ACTRT2 |
| Protein Name / Synonyms | ARPM2, ARPT2, Arp-T2, FLJ25424, HARPM2 |
| Clonality | Monoclonal |
| Immunogen Sequence | DKGLVDDIKKKLCYVALEPEKELSRRPEEVLREYKLPDGN IISLGDPLHQAPEALFVPQQLGSQSPGLSNMVSSSITKCD TDIQKILFGEI |
| Isotype | Kappa, IgG2a |
| Recommended Applications | IHC, Western Blotting, ELISA |
| Shipping Type | Blue ice |
| Storage | -20°C |
| More Information | Specificity Human |
![]() | Western Blot detection against Immunogen (35.75 KDa). |
![]() | ACTRT2 monoclonal antibody. Western Blot analysis of ACTRT2 expression in HepG2 . |
![]() | Western Blot analysis of ACTRT2 expression in transfected 293T cell line by ACTRT2 monoclonal antibody . Lane 1: ACTRT2 transfected lysate(41.7 KDa). Lane 2: Non-transfected lysate. |
![]() | Immunoperoxidase of monoclonal antibody to ACTRT2 on formalin-fixed paraffin-embedded human colon. [antibody concentration 3 ug/ml] |
Your cart is empty.