3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
Catalog #: 101-10029
Human ADAMTS4 monoclonal antibody (100 ug)
| Size | 100 µg |
| Estimated Lead Time | 1-2 weeks |
| Species | Human |
| Host Species | Mouse |
| Accession Number | AAH63293 |
| Gene Id | 9507 |
| Gene Symbols | ADAMTS4 |
| Protein Name / Synonyms | ADAMTS-2, ADAMTS-4, ADMP-1, KIAA0688 |
| Clonality | Monoclonal |
| Immunogen Sequence | RKFRYGYNNVVTIPAGATHILVRQQGNPGHRSIYLALKLP DGSYALNGEYTLMPSPTDVVLPGAVSLRYSGATAASETLS GHGPLAQPLTLQVLVAGNPQDTRLRYSFFV |
| Isotype | Kappa, IgG1 |
| Recommended Applications | Immunoprecipitation, ELISA |
| Shipping Type | Blue ice |
| Storage | -20°C |
| More Information | Specificity Human |
![]() | Immunoprecipitation of ADAMTS4 transfected lysate using anti-ADAMTS4 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with ADAMTS4 MaxPab rabbit polyclonal antibody. |
![]() | Detection limit for recombinant GST tagged ADAMTS4 is 0.3 ng/ml as a capture antibody. |
Your cart is empty.