3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
Catalog #: 101-10034
Human ADPGK monoclonal antibody (100 ug)
| Size | 100 µg |
| Estimated Lead Time | 1-2 weeks |
| Species | Human, Mouse, Rat |
| Host Species | Mouse |
| Accession Number | NP_112574 |
| Gene Id | 83440 |
| Gene Symbols | ADPGK |
| Protein Name / Synonyms | 2610017G09Rik, ADP-GK, DKFZp434B195 |
| Clonality | Monoclonal |
| Immunogen Sequence | SLRAPQEFMTSHSEAGSRIVLNPNKPVVEWHREGISFHFT PVLVCKDPIRTVGLGDAISAEGLFYSEVHPHY |
| Isotype | Kappa, IgG2a |
| Recommended Applications | ELISA, Western Blotting |
| Shipping Type | Blue ice |
| Storage | -20°C |
| More Information | Specificity Human |
![]() | Western Blot detection against Immunogen (33.66 KDa). |
![]() | Western blot analysis of ADPGK over-expressed 293 cell line, cotransfected with ADPGK Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with ADPGK monoclonal antibody. GAPDH ( 36.1 kDa ) used as specificity and loading control. |
![]() | ADPGK monoclonal antibody Western Blot analysis of ADPGK expression in Raw 264.7. |
![]() | ADPGK monoclonal antibody Western Blot analysis of ADPGK expression in PC-12. |
![]() | ADPGK monoclonal antibody Western Blot analysis of ADPGK expression in NIH/3T3. |
![]() | ADPGK monoclonal antibody Western Blot analysis of ADPGK expression in HeLa . |
![]() | Western Blot analysis of ADPGK expression in transfected 293T cell line by ADPGK monoclonal antibody. Lane 1: ADPGK transfected lysate(54.1 KDa). Lane 2: Non-transfected lysate. |
![]() | Detection limit for recombinant GST tagged ADPGK is 0.3 ng/ml as a capture antibody. |
Your cart is empty.