3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
Catalog #: 101-10039
Human AGR2 monoclonal antibody (100 ug)
| Size | 100 µg |
| Estimated Lead Time | 1-2 weeks |
| Species | Human |
| Host Species | Mouse |
| Accession Number | AAH15503.1 |
| Gene Id | 10551 |
| Gene Symbols | AGR2 |
| Protein Name / Synonyms | AG2, GOB-4, HAG-2, XAG-2 |
| Clonality | Monoclonal |
| Immunogen Sequence | MEKIPVSAFLLLVALSYTLARDTTVKPGAKKDTKDSRPKL PQTLSRGWGDQLIWTQTYEEALYKSKTSNKPLMIIHHLDE CPHSQALKKVFAENKEIQKLAEQFVLLNLVYETTDKHLSP DGQYVPRIMFVDPSLTVRADITGRYSNRLYAYEPADTALL LDNMKKALKLLKTEL |
| Isotype | Kappa, IgG2b |
| Recommended Applications | Western Blotting, ELISA |
| Shipping Type | Blue ice |
| Storage | -20°C |
| More Information | Specificity Human |
![]() | Western Blot detection against Immunogen (44.99 KDa). |
![]() | AGR2 monoclonal antibody Western Blot analysis of AGR2 expression in MCF-7 . |
![]() | Western Blot analysis of AGR2 expression in transfected 293T cell line by AGR2 monoclonal antibody. Lane 1: AGR2 transfected lysate(20 KDa). Lane 2: Non-transfected lysate. |
![]() | Detection limit for recombinant GST tagged AGR2 is approximately 3ng/ml as a capture antibody. |
Your cart is empty.