3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
Catalog #: 101-10054
Human AKT2 monoclonal antibody (100 ug)
| Size | 100 µg |
| Estimated Lead Time | 1-2 weeks |
| Species | Human, Mouse, Rat |
| Host Species | Mouse |
| Accession Number | AAA58364 |
| Gene Id | 208 |
| Gene Symbols | AKT2 |
| Protein Name / Synonyms | PKBB, PKBBETA, PRKBB, RAC-BETA |
| Clonality | Monoclonal |
| Immunogen Sequence | MRAIQMVANSLKQRAPGEDPMDYKCGSPSDSSTTEEMEVA VSKARAKVTMNDFDYLKLLGKGTFGKVILVREKATGRYYA MKILRKEVII |
| Isotype | Kappa, IgG1 |
| Recommended Applications | ELISA, Western Blotting, Immunofluorescence |
| Research Area | Akt Signaling |
| Shipping Type | Blue ice |
| Storage | -20°C |
| More Information | Specificity Human |
![]() | Western Blot detection against Immunogen (35.53 KDa). |
![]() | AKT2 monoclonal antibody Western Blot analysis of AKT2 expression in Raw 264.7. |
![]() | AKT2 monoclonal antibody Western Blot analysis of AKT2 expression in PC-12. |
![]() | AKT2 monoclonal antibody Western Blot analysis of AKT2 expression in NIH/3T3. |
![]() | AKT2 monoclonal antibody Western Blot analysis of AKT2 expression in Jurkat . |
![]() | Immunofluorescence of monoclonal antibody to AKT2 on HeLa cell. [antibody concentration 10 ug/ml] |
![]() | Detection limit for recombinant GST tagged AKT2 is approximately 1ng/ml as a capture antibody. |
Your cart is empty.