3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
Catalog #: 101-10059
Human ALF monoclonal antibody (100 ug)
| Size | 100 µg |
| Estimated Lead Time | 1-2 weeks |
| Species | Human |
| Host Species | Mouse |
| Accession Number | NP_006863 |
| Gene Id | 11036 |
| Gene Symbols | ALF,GTF2A1L |
| Protein Name / Synonyms | ALF, MGC26254 |
| Clonality | Monoclonal |
| Immunogen Sequence | PQVSQTNSNVESVLSGSASMAQNLHDESLSTSPHGALHQH VTDIQLHILKNRMYGCDSVKQPRNIEEPSNIPVSEKDSNS QVDLSIRVTDDDIGEIIQ |
| Isotype | Kappa, IgG1 |
| Recommended Applications | Immunoprecipitation, ELISA, Western Blotting |
| Shipping Type | Blue ice |
| Storage | -20°C |
| More Information | Specificity Human |
![]() | Western Blot detection against Immunogen (36.52 KDa). |
![]() | Immunoprecipitation of GTF2A1L transfected lysate using anti-GTF2A1L monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with GTF2A1L MaxPab rabbit polyclonal antibody. |
Your cart is empty.