3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
Catalog #: 101-10081
Human ANKRD37 monoclonal antibody (100 ug)
| Size | 100 µg |
| Estimated Lead Time | 1-2 weeks |
| Species | Human |
| Host Species | Mouse |
| Accession Number | NP_859077.1 |
| Gene Id | 353322 |
| Gene Symbols | ANKRD37 |
| Protein Name / Synonyms | Lrp2bp, MGC111507 |
| Clonality | Monoclonal |
| Immunogen Sequence | MLLLDCNPEVDGLKHLLETGASVNAPPDPCKQSPVHLAAG SGLACFLLWQLQTGADLNQQDVLGEAPLHKAAKVGSLECL SLLVASDAQIDLCNKNGQTAEDLAWSCGFPDCAKFLTTIK CMQTIKASEHPDRNDCVAVLRQKRSLGSVENTSGKRKC |
| Isotype | Kappa, IgG2a |
| Recommended Applications | Immunofluorescence, ELISA, Western Blotting |
| Shipping Type | Blue ice |
| Storage | -20°C |
| More Information | Specificity Human |
![]() | Western Blot detection against Immunogen (43.3 KDa). |
![]() | Immunofluorescence of monoclonal antibody to ANKRD37 on HeLa cell. [antibody concentration 10 ug/ml] |
![]() | Detection limit for recombinant GST tagged ANKRD37 is 0.1 ng/ml as a capture antibody. |
Your cart is empty.