3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
Catalog #: 101-10101
Human ARMC8 monoclonal antibody (100 ug)
| Size | 100 µg |
| Estimated Lead Time | 1-2 weeks |
| Species | Human |
| Host Species | Mouse |
| Accession Number | NP_054873 |
| Gene Id | 25852 |
| Gene Symbols | ARMC8 |
| Protein Name / Synonyms | HSPC056, MGC10058, MGC4880, S863-2 |
| Clonality | Monoclonal |
| Immunogen Sequence | AETLAYLIEPDVELQRIASITDHLIAMLADYFKYPSSVSA ITDIKRLDHDLKHAHELRQAAFKLYASLGANDEDIRKKVS LGEGRPPVLTASRQGVTST |
| Isotype | Kappa, IgG1 |
| Recommended Applications | Immunoprecipitation, ELISA, Western Blotting |
| Shipping Type | Blue ice |
| Storage | -20°C |
| More Information | Specificity Human |
![]() | Western Blot detection against Immunogen (36.63 KDa). |
![]() | Western Blot analysis of ARMC8 expression in transfected 293T cell line by ARMC8 monoclonal antibody. Lane 1: ARMC8 transfected lysate(43 KDa). Lane 2: Non-transfected lysate. |
![]() | Immunoprecipitation of ARMC8 transfected lysate using anti-ARMC8 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with ARMC8 monoclonal antibody. |
![]() | Detection limit for recombinant GST tagged ARMC8 is approximately 0.03ng/ml as a capture antibody. |
Your cart is empty.