3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
Catalog #: 101-10130
Human ATP6AP1 monoclonal antibody (100 ug)
| Size | 100 µg |
| Estimated Lead Time | 1-2 weeks |
| Species | Human, Rat |
| Host Species | Mouse |
| Accession Number | NP_001174 |
| Gene Id | 537 |
| Gene Symbols | ATP6AP1 |
| Protein Name / Synonyms | 16A, ATP6IP1, ATP6S1, Ac45, CF2, MGC129781, VATPS1, XAP-3, XAP3 |
| Clonality | Monoclonal |
| Immunogen Sequence | SSDRDLWAPAADTHEGHITSDLQLSTYLDPALELGPRNVL LFLQDKLSIEDFTAYGGVFGNKQDSAFSNLENALDLAPSS LVLPAVDWYAVSTLTTYLQE |
| Isotype | Kappa, IgG1 |
| Recommended Applications | ELISA, Western Blotting |
| Shipping Type | Blue ice |
| Storage | -20°C |
| More Information | Specificity Human |
![]() | Western Blot detection against Immunogen (36.74 KDa). |
![]() | ATP6AP1 monoclonal antibody Western Blot analysis of ATP6AP1 expression in PC-12 . |
![]() | ATP6AP1 monoclonal antibody Western Blot analysis of ATP6AP1 expression in HeLa . |
![]() | Western Blot analysis of ATP6AP1 expression in transfected 293T cell line by ATP6AP1 monoclonal antibody. Lane 1: ATP6AP1 transfected lysate(52 KDa). Lane 2: Non-transfected lysate. |
![]() | Detection limit for recombinant GST tagged ATP6AP1 is 0.1 ng/ml as a capture antibody. |
Your cart is empty.