3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
Catalog #: 101-10131
Human ATP6V1A monoclonal antibody (100 ug)
| Size | 100 µg |
| Estimated Lead Time | 1-2 weeks |
| Species | Human |
| Host Species | Mouse |
| Accession Number | NP_001681 |
| Gene Id | 523 |
| Gene Symbols | ATP6V1A |
| Clonality | Monoclonal |
| Immunogen Sequence | TLEVAKLIKDDFLQQNGYTPYDRFCPFYKTVGMLSNMIAF YDMARRAVETTAQSDNKITWSIIREHMGDILYKLSSMKFK DPLKDGEAKIKSDYAQLLEDMQNAFRSLED |
| Isotype | Kappa, IgG1 |
| Concentration (lot specific) | 0.45 mg/ml |
| Recommended Applications | Immunofluorescence, Western Blotting, ELISA, IHC |
| Shipping Type | Blue ice |
| Storage | -20°C |
![]() | Western Blot detection against Immunogen (37.84 KDa). | ||||
![]() | ATP6V1A monoclonal antibody Western Blot analysis of ATP6V1A expression in human kidney. | ||||
![]() | Western Blot analysis of ATP6V1A expression in transfected 293T cell line by ATP6V1A monoclonal antibody. Lane 1: ATP6V1A transfected lysate (Predicted MW: 68.3 KDa). Lane 2: Non-transfected lysate. | ||||
![]() | Immunoperoxidase of monoclonal antibody to ATP6V1A on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3 ug/ml] | ![]() | Immunofluorescence of monoclonal antibody to ATP6V1A on HeLa cell. [antibody concentration 10 ug/ml] | ![]() | Detection limit for recombinant GST tagged ATP6V1A is 0.03 ng/ml as a capture antibody. |
Your cart is empty.