Human BAG1 monoclonal antibody (100 ug)
Loading...
Loading...
Loading...
Loading...
| Size | 100 µg |
| Estimated Lead Time | 1-2 weeks |
| Species | Human, Mouse, Rat |
| Host Species | Mouse |
| Accession Number | NP_004314 |
| Gene Id | 573 |
| Gene Symbols | BAG1 |
| Clonality | Monoclonal |
| Immunogen Sequence | EKIADQLEELNKELTGIQQGFLPKDLQAEALCKLDRRVKA TIEQFMKILEEIDTLILPENFKDSRLKRKGLVKKVQAFLA ECDTVEQNICQETERLQSTNFALAE |
| Isotype | Kappa, IgG2a |
| Concentration (lot specific) | 0.5 mg/ml |
| Recommended Applications | ELISA, Western Blotting, Immunofluorescence, IHC |
| Shipping Type | Blue ice |
| Storage | -20°C |
![]() | Western Blot detection against Immunogen (37.29 KDa). | ||||
![]() | BAG1 monoclonal antibody Western Blot analysis of BAG1 expression in Raw 264.7. | ||||
![]() | BAG1 monoclonal antibody Western Blot analysis of BAG1 expression in PC-12. | ||||
![]() | BAG1 monoclonal antibody Western Blot analysis of BAG1 expression in NIH/3T3. | ![]() | BAG1 monoclonal antibody Western Blot analysis of BAG1 expression in LNCaP . | ![]() | BAG1 monoclonal antibody Western Blot analysis of BAG1 expression in Jurkat . |
![]() | BAG1 monoclonal antibody Western Blot analysis of BAG1 expression in HeLa . | ||||
![]() | Immunoperoxidase of monoclonal antibody to BAG1 on formalin-fixed paraffin-embedded human tonsil. [antibody concentration 3 ug/ml] | ||||
![]() | Immunofluorescence of monoclonal antibody to BAG1 on HeLa cell. [antibody concentration 35 ug/ml] | ||||
![]() | Detection limit for recombinant GST tagged BAG1 is approximately 0.03ng/ml as a capture antibody. |
Anti-BAG1 Antibody
Anti-BAG1 Antibody
Your cart is empty.