3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
Catalog #: 101-10153
Human BCAP31 monoclonal antibody (200 uL)
| Size | 200 µL |
| Estimated Lead Time | 1-2 weeks |
| Species | Human |
| Host Species | Mouse |
| Accession Number | NP_005736 |
| Gene Id | 10134 |
| Gene Symbols | BCAP31 |
| Protein Name / Synonyms | 6C6-AG, BAP31, CDM, DXS1357E |
| Clonality | Monoclonal |
| Immunogen Sequence | KKQAESASEAAKKYMEENDQLKKGAAVDGGKLDVGNAEVK LEEENRSLKADLQKLKDELASTKQKLEKAENQVLAMRKQS EGLTKEYDRLLEEHAKLQAAVDGPMDKKEE |
| Isotype | Kappa, IgG1 |
| Recommended Applications | Western Blotting, ELISA |
| Shipping Type | Blue ice |
| Storage | -20°C |
| More Information | Specificity Human |
![]() | Western Blot detection against Immunogen (37.84 KDa). |
![]() | BCAP31 monoclonal antibody Western Blot analysis of BCAP31 expression in human kidney. |
![]() | BCAP31 monoclonal antibody Western Blot analysis of BCAP31 expression in HeLa. |
Your cart is empty.