3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
Anti-BD-1 (32-66) Antibody
Catalog #: 130-10577
Rabbit anti-Human BD-1(32-66) Antibody
Product Description
Specifications
| Size | 20 µg, 100 µg, 200 µg, 500 µg |
| Estimated Lead Time | 1-2 business days |
| Species | Human |
| Accession Number | P60022 |
| Gene Id | 1672 |
| Gene Symbols | DEFB1 BD1 HBD1 |
| Protein Name / Synonyms | BD-1(32-66) |
| Clonality | Polyclonal |
| Immunogen | This antibody was produced from antiserum of rabbits immunized with a synthetic immunogen BD-1(32-66):DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKC). This antibody was produced from a rabbit immunized with this peptide conjugated with KLH.The IgG fraction was purified by Protein A affinity chromatography. |
| Immunogen Sequence | DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKC |
| Recommended Applications | ELISA (recommended work dilution= 1:128, 000) |
| Reconstitution | Product is supplied as a powder obtained from lyophilization of purified antibody in 1X PBS, aliquot using ddH2O. Reconstitute the antibody with sterile water to a final concentration of 1 mg/ml. |
| Shipping Type | Ambient temperature |
| Storage | -20°C |
Description
Description
Defensins form a family of microbicidal and cytotoxic peptides made by neutrophils. Members of the defensin family are highly similar in protein sequence. This gene encodes defensin, beta 1,an antimicrobial peptide implicated in the resistance of epithelial surfaces to microbial colonization. This gene maps in close proximity to defensin family member, defensin, alpha 1 and has been implicated in the pathogenesis of cystic fibrosis. DEFB1 (Defensin Beta 1) is a Protein Coding gene. Diseases associated with DEFB1 include Endophthalmitis and Tonsillitis. Among its related pathways are Defensins and Innate Immune System.
Storage
The antibody is stable for at least 1 year from the date of receipt when stored at -20°C to -70°C. Reconstituted antibody can also be aliquotted and stored at 4°C for 1 month or at -20°C to -70°C in a manual defrost freezer for many months without detectable loss activity. Please avoid freeze-thaw cycles.
Expiration:
12 months from the date of shipment when stored properly.