3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
Catalog #: 101-10162
Human BIN1 monoclonal antibody (100 ug)
| Size | 100 µg |
| Estimated Lead Time | 1-2 weeks |
| Species | Human |
| Host Species | Mouse |
| Accession Number | NP_004296 |
| Gene Id | 274 |
| Gene Symbols | BIN1 |
| Protein Name / Synonyms | AMPH2, AMPHL, DKFZp547F068, MGC10367, SH3P9 |
| Clonality | Monoclonal |
| Immunogen Sequence | VVETFPATVNGTVEGGSGAGRLDLPPGFMFKVQAQHDYTA TDTDELQLKAGDVVLVIPFQNPEEQDEGWLMGVKESDWNQ HKELEKCRGVFPENFTERVP |
| Isotype | Kappa, IgG1 |
| Recommended Applications | Western Blotting, ELISA |
| Shipping Type | Blue ice |
| Storage | -20°C |
| More Information | Specificity Human |
![]() | Western Blot detection against Immunogen (36.74 KDa). |
![]() | BIN1 monoclonal antibody Western Blot analysis of BIN1 expression in HeLa NE . |
![]() | Western Blot analysis of BIN1 expression in transfected 293T cell line by BIN1 monoclonal antibody. Lane 1: BIN1 transfected lysate(53 KDa). Lane 2: Non-transfected lysate. |
Your cart is empty.