3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
Catalog #: 101-10215
Human CAPN9 monoclonal antibody (100 ug)
| Size | 100 µg |
| Estimated Lead Time | 1-2 weeks |
| Species | Human |
| Host Species | Mouse |
| Accession Number | NP_006606 |
| Gene Id | 10753 |
| Gene Symbols | CAPN9 |
| Protein Name / Synonyms | GC36, nCL-4 |
| Clonality | Monoclonal |
| Immunogen Sequence | DKLKQWINLFLRFDADKSGTMSTYELRTALKAAGFQLSSH LLQLIVLRYADEELQLDFDDFLNCLVRLENASRVFQALST KNKEFIHLNINEFIHLTMNI |
| Isotype | Kappa, IgG2a |
| Recommended Applications | Western Blotting, IHC, ELISA |
| Shipping Type | Blue ice |
| Storage | -20°C |
| More Information | Specificity Human |
![]() | Western Blot detection against Immunogen (36.74 KDa). |
![]() | CAPN9 monoclonal antibody Western Blot analysis of CAPN9 expression in human colon. |
![]() | Immunoperoxidase of monoclonal antibody to CAPN9 on formalin-fixed paraffin-embedded human liver. [antibody concentration 1 ug/ml] |
![]() | Detection limit for recombinant GST tagged CAPN9 is approximately 0.1ng/ml as a capture antibody. |
Your cart is empty.