3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
Catalog #: 101-10225
Human CBFA2T2 monoclonal antibody (100 ug)
| Size | 100 µg |
| Estimated Lead Time | 1-2 weeks |
| Species | Human |
| Host Species | Mouse |
| Accession Number | NP_001028171.1 |
| Gene Id | 9139 |
| Gene Symbols | CBFA2T2 |
| Protein Name / Synonyms | DKFZp313F2116, EHT, MTGR1, ZMYND3 |
| Clonality | Monoclonal |
| Immunogen Sequence | LLLNTSIASPADSSELLMEVHGNGKRPSPERREENSFDRD TIAPEPPAKRVCTISPAPRHSPALTVPLMNPGGQFHPTPP PLQHYTLEDIATSHLYREPNKMLE |
| Isotype | Kappa, IgG2b |
| Recommended Applications | ELISA, IHC, Western Blotting |
| Shipping Type | Blue ice |
| Storage | -20°C |
| More Information | Specificity Human |
![]() | Western Blot detection against Immunogen (37.18 KDa). |
![]() | Western Blot analysis of CBFA2T2 expression in transfected 293T cell line by CBFA2T2 monoclonal antibody . Lane 1: CBFA2T2 transfected lysate(63.9 KDa). Lane 2: Non-transfected lysate. |
![]() | Immunoperoxidase of monoclonal antibody to CBFA2T2 on formalin-fixed paraffin-embedded human salivary gland. [antibody concentration 3 ug/ml] |
![]() | Detection limit for recombinant GST tagged CBFA2T2 is 0.3 ng/ml as a capture antibody. |
Your cart is empty.