3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
Catalog #: 129-10142
Goat Anti-Human CD284 (N-term.) (0.1 mg)
| Size | 0.1 mg |
| Estimated Lead Time | 1-2 weeks |
| Species | Human |
| Host Species | Goat |
| Protein Name / Synonyms | CD284 |
| Immunogen Sequence | LIQSFKLPEYFSNLTNLEHLDLSSNKIQSIYC |
| Concentration (lot specific) | 1.0mg/ml |
| Recommended Applications | Immunohistology - Paraffin, Western Blotting |
| Research Area | Adaptive Immunity |
| Shipping Type | Blue ice |
| Storage | -20°C |
Store at +4 °C or at -20 °C if preferred.
Storage in frost-free freezers is not recommended.
This product should be stored undiluted. Avoid repeated freezing and thawing as this may denature the antibody. Should this product contain a precipitate we recommend microcentrifugation before use.
If stored in this manner, this product is stable for 18 months after receipt.
Antiserum to human CD284 (NT) was raised by repeated immunisation of goats with highly purified antigen. Purified IgG was prepared by affinity chromatography.
Your cart is empty.