3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
Catalog #: 101-10287
Human CFLAR monoclonal antibody (100 ug)
| Size | 100 µg |
| Estimated Lead Time | 1-2 weeks |
| Species | Human |
| Host Species | Mouse |
| Accession Number | AAH01602 |
| Gene Id | 8837 |
| Gene Symbols | CFLAR |
| Protein Name / Synonyms | CASH, CASP8AP1, CLARP, Casper, FLAME, FLAME-1, FLAME1, FLIP, I-FLICE, MRIT, c-FLIP, c-FLIPL, c-FLIPR, c-FLIPS |
| Clonality | Monoclonal |
| Immunogen Sequence | AGTSYRNVLQAAIQKSLKDPSNNFRLHNGRSKEQRLKEQL GAQQEPVKKSIQESEAFLPQSIPEERYKMKSKPLGICLII DCIGNETELLRDTFTSLGYE |
| Isotype | Kappa, IgG2a |
| Recommended Applications | Western Blotting, IHC, ELISA, Immunofluorescence |
| Shipping Type | Blue ice |
| Storage | -20°C |
| More Information | Specificity Human |
![]() | Western Blot detection against Immunogen (36.63 KDa). |
![]() | CFLAR monoclonal antibody. Western Blot analysis of CFLAR expression in K-562. |
![]() | CFLAR monoclonal antibody Western Blot analysis of CFLAR expression in IMR-32 . |
![]() | Western Blot analysis of CFLAR expression in transfected 293T cell line by CFLAR monoclonal antibody . Lane 1: CFLAR transfected lysate (Predicted MW: 55.3 KDa). Lane 2: Non-transfected lysate. |
![]() | Immunoperoxidase of monoclonal antibody to CFLAR on formalin-fixed paraffin-embedded human kidney. [antibody concentration 3 ug/ml] |
![]() | Immunofluorescence of monoclonal antibody to CFLAR on HeLa cell. [antibody concentration 10 ug/ml] |
![]() | Detection limit for recombinant GST tagged CFLAR is approximately 0.3ng/ml as a capture antibody. |
Your cart is empty.