3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
Catalog #: 101-10299
Human CKMT1B monoclonal antibody (100 ug)
| Size | 100 µg |
| Estimated Lead Time | 1-2 weeks |
| Species | Human |
| Host Species | Mouse |
| Accession Number | NP_066270 |
| Gene Id | 1159 |
| Gene Symbols | CKMT1B |
| Protein Name / Synonyms | CKMT, CKMT1, UMTCK |
| Clonality | Monoclonal |
| Immunogen Sequence | GVHIKLPLLSKDSRFPKILENLRLQKRGTGGVDTAATGGV FDISNLDRLGKSEVELVQLVIDGVNYLIDCERRLERGQDI RIPTPVIHTKH |
| Isotype | Kappa, IgG2a |
| Recommended Applications | Western Blotting, ELISA |
| Shipping Type | Blue ice |
| Storage | -20°C |
| More Information | Specificity Human |
![]() | Western Blot detection against Immunogen (35.75 KDa). |
![]() | Western blot analysis of CKMT1B over-expressed 293 cell line, cotransfected with CKMT1B Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with CKMT1B monoclonal antibody. GAPDH ( 36.1 kDa ) used as specificity and loading control. |
![]() | CKMT1B monoclonal antibody Western Blot analysis of CKMT1B expression in A-431 . |
![]() | Western Blot analysis of CKMT1B expression in transfected 293T cell line by CKMT1B monoclonal antibody. Lane 1: CKMT1B transfected lysate(47 KDa). Lane 2: Non-transfected lysate. |
![]() | Detection limit for recombinant GST tagged CKMT1B is approximately 0.1ng/ml as a capture antibody. |
Your cart is empty.