3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
Catalog #: 101-10334
Human CROT monoclonal antibody (100 ug)
| Size | 100 µg |
| Estimated Lead Time | 1-2 weeks |
| Species | Human, Mouse, Rat |
| Host Species | Mouse |
| Accession Number | NP_066974 |
| Gene Id | 54677 |
| Gene Symbols | CROT |
| Protein Name / Synonyms | COT |
| Clonality | Monoclonal |
| Immunogen Sequence | ENQLAKSTEERTFQYQDSLPSLPVPSLEESLKKYLESVKP FANQEEYKKTEEIVQKFQSGIGEKLHQKLLERAKGKRNWL EEWWLNVAYLDVRIPSQL |
| Isotype | Kappa, IgG1 |
| Recommended Applications | ELISA, Western Blotting |
| Shipping Type | Blue ice |
| Storage | -20°C |
| More Information | Specificity Human |
![]() | Western Blot detection against Immunogen (36.52 KDa). |
![]() | CROT monoclonal antibody Western Blot analysis of CROT expression in Raw 264.7 . |
![]() | CROT monoclonal antibody Western Blot analysis of CROT expression in PC-12 . |
![]() | CROT monoclonal antibody Western Blot analysis of CROT expression in NIH/3T3 . |
![]() | CROT monoclonal antibody Western Blot analysis of CROT expression in HeLa . |
Your cart is empty.