3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
Catalog #: 101-10335
Human CRSP9 monoclonal antibody (100 ug)
| Size | 100 µg |
| Estimated Lead Time | 1-2 weeks |
| Species | Human |
| Host Species | Mouse |
| Accession Number | AAH05250 |
| Gene Id | 9443 |
| Gene Symbols | CRSP9,MED7 |
| Protein Name / Synonyms | CRSP33, CRSP9, MGC12284 |
| Clonality | Monoclonal |
| Immunogen Sequence | MGEPQQVSALPPPPMQYIKEYTDENIQEGLAPKPPPPIKD SYMMFGNQFQCDDLIIRPLESQGIERLHPMQFDHKKELRK LNMSILINFLDLLDILIRSPGSIKREEKLEDLKLLFVHVH HLINEYRPHQARETLRVMMEVQKRQRLETAERFQKHLERV IEMIQNCLASLPDDLPHSEAGMRVKTEPMDADDSNNCTGQ NEHQRENSGHRRDQIIEKDAALCVLIDEMNERP |
| Isotype | Kappa, IgG2b |
| Recommended Applications | Western Blotting, ELISA |
| Shipping Type | Blue ice |
| Storage | -20°C |
| More Information | Specificity Human |
![]() | Western Blot detection against Immunogen (51.37 KDa). |
![]() | Western blot analysis of CRSP9 over-expressed 293 cell line, cotransfected with CRSP9 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with CRSP9 monoclonal antibody. GAPDH ( 36.1 kDa ) used as specificity and loading control. |
![]() | CRSP9 monoclonal antibody Western Blot analysis of CRSP9 expression in Jurkat . |
![]() | Western Blot analysis of CRSP9 expression in transfected 293T cell line by CRSP9 monoclonal antibody. Lane 1: CRSP9 transfected lysate(27.2 KDa). Lane 2: Non-transfected lysate. |
![]() | Detection limit for recombinant GST tagged CRSP9 is approximately 0.3ng/ml as a capture antibody. |
Your cart is empty.