3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
Catalog #: 101-10355
Human CTNNB1 monoclonal antibody (100 ug)
| Size | 100 µg |
| Estimated Lead Time | 1-2 weeks |
| Species | Human |
| Host Species | Mouse |
| Accession Number | AAH58926 |
| Gene Id | 1499 |
| Gene Symbols | CTNNB1 |
| Protein Name / Synonyms | CTNNB, DKFZp686D02253, FLJ25606, FLJ37923 |
| Clonality | Monoclonal |
| Immunogen Sequence | LFRTEPMAWNETADLGLDIGAQGEPLGYRQDDPSYRSFHS GGYGQDALGMDPMMEHEMGGHHPGADYPVDGLPDLGHAQD LMDGLPPGDSNQLAWFDTDL |
| Isotype | Kappa, IgG2a |
| Recommended Applications | Immunofluorescence, ELISA, Proximity Ligation Analysis, Western Blotting |
| Research Area | Wnt-beta-Catenin Signaling |
| Shipping Type | Blue ice |
| Storage | -20°C |
| More Information | Specificity Human |
![]() | Western Blot detection against Immunogen (36.74 KDa). |
![]() | Western Blot analysis of CTNNB1 expression in transfected 293T cell line by CTNNB1 monoclonal antibody. Lane 1: CTNNB1 transfected lysate(85.5 KDa). Lane 2: Non-transfected lysate. |
![]() | Proximity Ligation Analysis of protein-protein interactions between PIK3R1 and CTNNB1 HeLa cells were stained with anti-PIK3R1 rabbit purified polyclonal 1:1200 and anti-CTNNB1 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue). |
![]() | Immunofluorescence of monoclonal antibody to CTNNB1 on HeLa cell. [antibody concentration 10 ug/ml] |
![]() | Detection limit for recombinant GST tagged CTNNB1 is 0.1 ng/ml as a capture antibody. |
Your cart is empty.