3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
Catalog #: 101-10358
Human CXCL11 monoclonal antibody (200 uL)
| Size | 200 µL |
| Estimated Lead Time | 1-2 weeks |
| Species | Human |
| Host Species | Mouse |
| Accession Number | AAH05292 |
| Gene Id | 6373 |
| Gene Symbols | CXCL11 |
| Protein Name / Synonyms | H174, I-TAC, IP-9, IP9, MGC102770, SCYB11, SCYB9B, b-R1 |
| Clonality | Monoclonal |
| Immunogen Sequence | MSVKGMAIALAVILCATVVQGFPMFKRGRCLCIGPGVKAV KVADIEKASIMYPSNNCDKIEVIITLKENKGQRCLNPKSK QARLIIKKVERKNF |
| Isotype | Kappa, IgM |
| Recommended Applications | Immunoprecipitation, ELISA |
| Research Area | Inflammation, Chemokine Biology |
| Shipping Type | Blue ice |
| Storage | -20°C |
| More Information | Specificity Human |
![]() | Immunoprecipitation of CXCL11 transfected lysate using anti-CXCL11 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with CXCL11 MaxPab rabbit polyclonal antibody. |
Your cart is empty.