3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
Catalog #: 101-10379
Human DC-UbP monoclonal antibody (100 ug)
| Size | 100 µg |
| Estimated Lead Time | 1-2 weeks |
| Species | Human |
| Host Species | Mouse |
| Accession Number | AAH19910 |
| Gene Id | 92181 |
| Gene Symbols | DC-UbP,UBTD2 |
| Protein Name / Synonyms | DC-UbP, DCUBP, MGC30022 |
| Clonality | Monoclonal |
| Immunogen Sequence | MTDGQLRSKRDEFWDTAPAFEGRKEIWDALKAAAHAFESN DHELAQAIIDGANITLPHGALTECYDELGNRYQLPVYCLA PPINMIEEKSDIETLDIPEPPPNSGYECQLRLRLSTGKDL KLVVRSTDTVFHMKRRLHAAEGVEPGSQRWFFSGRPLTDK MKFEELKIPKDYVVQVIVSQPVQNPTPVEN |
| Isotype | Kappa, IgG1 |
| Recommended Applications | Western Blotting, ELISA |
| Shipping Type | Blue ice |
| Storage | -20°C |
| More Information | Specificity Human |
![]() | Western Blot detection against Immunogen (46.64 KDa). |
![]() | DC-UbP monoclonal antibody 1B1 Western Blot analysis of DC-UbP expression in A-431 . |
![]() | Western Blot analysis of DC-UbP expression in transfected 293T cell line by DC-UbP monoclonal antibody 1B1. Lane 1: DC-UbP transfected lysate(21.5 KDa). Lane 2: Non-transfected lysate. |
![]() | Detection limit for recombinant GST tagged DC-UbP is approximately 0.1ng/ml as a capture antibody. |