3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
Catalog #: 101-10376
Human DCAKD monoclonal antibody (100 ug)
| Size | 100 µg |
| Estimated Lead Time | 1-2 weeks |
| Species | Human |
| Host Species | Mouse |
| Accession Number | NP_079095 |
| Gene Id | 79877 |
| Gene Symbols | DCAKD |
| Protein Name / Synonyms | FLJ22955 |
| Clonality | Monoclonal |
| Immunogen Sequence | DIPLLFETKKLLKYMKHTVVVYCDRDTQLARLMRRNSLNR KDAEARINAQLPLTDKARMARHVLDNSGEWSVTKRQVILL HTELERSL |
| Isotype | Kappa, IgG1 |
| Recommended Applications | ELISA, Western Blotting, Immunofluorescence, IHC |
| Shipping Type | Blue ice |
| Storage | -20°C |
| More Information | Specificity Human |
![]() | Western Blot detection against Immunogen (35.42 KDa). |
![]() | DCAKD monoclonal antibody Western Blot analysis of DCAKD expression in MCF-7 . |
![]() | Immunoperoxidase of monoclonal antibody to DCAKD on formalin-fixed paraffin-embedded human tonsil. [antibody concentration 3 ug/ml] |
![]() | Immunofluorescence of monoclonal antibody to DCAKD on MCF-7 cell. [antibody concentration 10 ug/ml] |
Your cart is empty.