3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
Catalog #: 101-10389
Human DDX54 monoclonal antibody (100 ug)
| Size | 100 µg |
| Estimated Lead Time | 1-2 weeks |
| Species | Human |
| Host Species | Mouse |
| Accession Number | NP_076977 |
| Gene Id | 79039 |
| Gene Symbols | DDX54 |
| Protein Name / Synonyms | DP97, MGC2835 |
| Clonality | Monoclonal |
| Immunogen Sequence | DDRDSDEEGASDRRGPERRGGKRDRGQGASRPHAPGTPAG RVRPELKTKQQILKQRRRAQKLHFLQRGGLKQLSARNRRR VQELQQGAFGRGARSKKGKMRKRM |
| Isotype | Kappa, IgG2a |
| Recommended Applications | ELISA, Western Blotting, Immunofluorescence, IHC |
| Shipping Type | Blue ice |
| Storage | -20°C |
| More Information | Specificity Human |
![]() | Western Blot detection against Immunogen (37.18 KDa). |
![]() | DDX54 monoclonal antibody Western Blot analysis of DDX54 expression in HeLa . |
![]() | Western Blot analysis of DDX54 expression in transfected 293T cell line by DDX54 monoclonal antibody. Lane 1: DDX54 transfected lysate(98.6 KDa). Lane 2: Non-transfected lysate. |
![]() | Immunoperoxidase of monoclonal antibody to DDX54 on formalin-fixed paraffin-embedded human ovary, clear cell carcinoma. [antibody concentration 3 ug/ml] |
![]() | Immunofluorescence of monoclonal antibody to DDX54 on HeLa cell. [antibody concentration 10 ug/ml] |
![]() | Detection limit for recombinant GST tagged DDX54 is 0.03 ng/ml as a capture antibody. |
Your cart is empty.