Anti-Defensin, beta-2 (a.a. 4-41) Antibody

Catalog #: MD-14-0244

Mouse Anti-Human Defensin, beta-2 (aa 4-41) (1 mg)

Product Description

Size	1mg
Estimated Lead Time	3-4 weeks
Species	Human
Host Species	Mouse
Protein Name / Synonyms	Defensin, beta-2
Concentration (lot specific)	1 mg/ml (prior to lyophilization)
Recommended Applications	Suitable for use in ELISA.
Shipping Type	Ambient temperature
Storage	-20°C

Synthetic human beta-Defensin 2 (a.a. 4-41)

Store lyophilized product at 2-8 °C. After reconstitution, store at -20°C. Avoid multiple freeze/thaw cycles.

Immunogen

Synthetic human beta-Defensin 2 (aa 4-41, DPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP)

Format Type:

Purified Liquid

Formulation:

Lyophilized from 50mM Tris, pH 7.4

Expiration:

12 months from the date of shipment when stored properly.