3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
Catalog #: 101-10407
Human DLX5 monoclonal antibody (100 ug)
| Size | 100 µg |
| Estimated Lead Time | 1-2 weeks |
| Species | Human, Mouse, Rat |
| Host Species | Mouse |
| Accession Number | NP_005212 |
| Gene Id | 1749 |
| Gene Symbols | DLX5 |
| Protein Name / Synonyms | None |
| Clonality | Monoclonal |
| Immunogen Sequence | KIKKIMKNGEMPPEHSPSSSDPMACNSPQSPAVWEPQGSS RSLSHHPHAHPPTSNQSPASSYLENSASWYTSAASSINSH LPPPGSLQH |
| Isotype | Kappa, IgG1 |
| Recommended Applications | Immunofluorescence, ELISA, Western Blotting |
| Shipping Type | Blue ice |
| Storage | -20°C |
| More Information | Specificity Human |
![]() | Western Blot detection against Immunogen (35.79 KDa). |
![]() | DLX5 monoclonal antibody. Western Blot analysis of DLX5 expression in Raw 264.7 . |
![]() | DLX5 monoclonal antibody. Western Blot analysis of DLX5 expression in PC-12 . |
![]() | DLX5 monoclonal antibody. Western Blot analysis of DLX5 expression in NIH/3T3 . |
![]() | DLX5 monoclonal antibody Western Blot analysis of DLX5 expression in A-431 . |
![]() | Western Blot analysis of DLX5 expression in transfected 293T cell line by DLX5 monoclonal antibody . Lane 1: DLX5 transfected lysate(31.5 KDa). Lane 2: Non-transfected lysate. |
![]() | Immunofluorescence of monoclonal antibody to DLX5 on HeLa cell. [antibody concentration 10 ug/ml] |
Your cart is empty.