3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
Catalog #: 101-10426
Human DTX3L monoclonal antibody (100 ug)
| Size | 100 µg |
| Estimated Lead Time | 1-2 weeks |
| Species | Human |
| Host Species | Mouse |
| Accession Number | NP_612144 |
| Gene Id | 151636 |
| Gene Symbols | DTX3L |
| Clonality | Monoclonal |
| Immunogen Sequence | SHLRPPSPLLVRVYKSGPRVRRKLESYFQSSKSSGGGECT VSTQEHEAPGTFRVEFSERAAKERVLKKGEHQILVDEKPV PIFLVPTENSIKKNTRPQISSLTQSQAE |
| Isotype | Kappa, IgG2a |
| Concentration (lot specific) | 0.44 mg/ml |
| Recommended Applications | IHC, ELISA, Western Blotting |
| Shipping Type | Blue ice |
| Storage | -20°C |
![]() | Western Blot detection against Immunogen (37.62 KDa). |
![]() | DTX3L monoclonal antibody Western Blot analysis of DTX3L expression in A-431 . |
![]() | Immunoperoxidase of monoclonal antibody to DTX3L on formalin-fixed paraffin-embedded human pancreas. [antibody concentration 6 ug/ml] |
![]() | Detection limit for recombinant GST tagged DTX3L is approximately 0.3ng/ml as a capture antibody. |
Your cart is empty.