3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
Catalog #: 101-10480
Human EPHB6 monoclonal antibody (100 ug)
| Size | 100 µg |
| Estimated Lead Time | 1-2 weeks |
| Species | Human, Mouse, Rat |
| Host Species | Mouse |
| Accession Number | NP_004436 |
| Gene Id | 2051 |
| Gene Symbols | EPHB6 |
| Protein Name / Synonyms | HEP, MGC129910, MGC129911 |
| Clonality | Monoclonal |
| Immunogen Sequence | DTTGETSEIGWLTYPPGGWDEVSVLDDQRRLTRTFEACHV AGAPPGTGQDNWLQTHFVERRGAQRAHIRLHFSVRACSSL GVSGGTCRETFTLYYRQAEE |
| Isotype | Kappa, IgG2a |
| Recommended Applications | ELISA, Western Blotting, IHC |
| Shipping Type | Blue ice |
| Storage | -20°C |
| More Information | Specificity Human |
![]() | Western Blot detection against Immunogen (36.63 KDa). |
![]() | EPHB6 monoclonal antibody Western Blot analysis of EPHB6 expression in PC-12 . |
![]() | EPHB6 monoclonal antibody Western Blot analysis of EPHB6 expression in NIH/3T3 . |
![]() | Immunoperoxidase of monoclonal antibody to EPHB6 on formalin-fixed paraffin-embedded human pancreas. [antibody concentration 3 ug/ml] |
![]() | Detection limit for recombinant GST tagged EPHB6 is approximately 0.3ng/ml as a capture antibody. |
Your cart is empty.