3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
Catalog #: 101-10487
Human EXOSC1 monoclonal antibody (100 ug)
| Size | 100 µg |
| Estimated Lead Time | 1-2 weeks |
| Species | Human |
| Host Species | Mouse |
| Accession Number | AAH22067 |
| Gene Id | 51013 |
| Gene Symbols | EXOSC1 |
| Protein Name / Synonyms | CGI-108, CSL4, Csl4p, SKI4, Ski4p, hCsl4p, p13 |
| Clonality | Monoclonal |
| Immunogen Sequence | MAPPVRYCIPGERLCNLEEGSPGSGTYTRHGYIFSSLAGC LMKSSENGALPVVSVVRETESQLLPDVGAIVTCKVSSINS RFAKVHILYVGSMPLKNSFRGTIRKEDVRATEKDKVEIYK SFRPGDIVLAKVISLGDAQSNYLLTTAENELGVVVAHSES GIQMVPISWCEMQCPKTHTKEFRKVARVQPEFLQT |
| Isotype | Kappa, IgG2b |
| Recommended Applications | Immunofluorescence, Western Blotting, ELISA |
| Shipping Type | Blue ice |
| Storage | -20°C |
| More Information | Specificity Human |
![]() | Western Blot detection against Immunogen (47.19 KDa). |
![]() | Western Blot analysis of EXOSC1 expression in transfected 293T cell line by EXOSC1 monoclonal antibody. Lane 1: EXOSC1 transfected lysate (Predicted MW: 21.5 KDa). Lane 2: Non-transfected lysate. |
![]() | Immunofluorescence of monoclonal antibody to EXOSC1 on HeLa cell. [antibody concentration 10 ug/ml] |
![]() | Detection limit for recombinant GST tagged EXOSC1 is 3 ng/ml as a capture antibody. |
Your cart is empty.