3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
Catalog #: 101-10504
Human FAS monoclonal antibody (100 ug)
| Size | 100 µg |
| Estimated Lead Time | 1-2 weeks |
| Species | Human |
| Host Species | Mouse |
| Accession Number | NP_000034 |
| Gene Id | 355 |
| Gene Symbols | FAS |
| Protein Name / Synonyms | ALPS1A, APO-1, APT1, CD95, FAS1, FASTM, TNFRSF6 |
| Clonality | Monoclonal |
| Immunogen Sequence | SKSVNAQVTDINSKGLELRKTVTTVETQNLEGLHHDGQFC HKPCPPGERKARDCTVNGDEPDCVPCQEGKEYTDKAHFSS KCRRCRLCDEGHGLEVEINC |
| Isotype | Kappa, IgG2a |
| Recommended Applications | ELISA, Proximity Ligation Analysis, Western Blotting |
| Shipping Type | Blue ice |
| Storage | -20°C |
| More Information | Specificity Human |
![]() | Western Blot detection against Immunogen (36.74 KDa). |
![]() | Western Blot analysis of FAS expression in transfected 293T cell line by FAS monoclonal antibody. Lane 1: FAS transfected lysate(37.732 KDa). Lane 2: Non-transfected lysate. |
![]() | Proximity Ligation Analysis of protein-protein interactions between FADD and FAS. HeLa cells were stained with anti-FADD rabbit purified polyclonal 1:1200 and anti-FAS mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue). |
![]() | Detection limit for recombinant GST tagged FAS is 3 ng/ml as a capture antibody. |
Your cart is empty.