Anti-FGF5 Antibody

Product Description

Size	100 µg
Estimated Lead Time	1-2 weeks
Species	Human
Host Species	Mouse
Accession Number	NP_004455.2
Gene Id	2250
Gene Symbols	FGF5
Protein Name / Synonyms	HBGF-5, Smag-82
Clonality	Monoclonal
Immunogen Sequence	DCKFRERFQENSYNTYASAIHRTEKTGREWYVALNKRGKA KRGCSPRVKPQHISTHFLPRFKQSEQPELSFTVTVPEKKK PPSPIKPKIPLSAPRKNTNSVKYRLKFRFG
Isotype	Kappa, IgG1
Recommended Applications	ELISA, Immunoprecipitation, Western Blotting, Proximity Ligation Analysis
Shipping Type	Blue ice
Storage	-20°C
More Information	Specificity Human

HBGF-5, Smag-82

Mouse monoclonal antibody raised against a partial recombinant FGF5.

Specificity

Human

Gene Accession #

NM_004464

Storage Buffer

1x PBS, pH 7.2

	FGF5 monoclonal antibody Western Blot analysis of FGF5 expression in human colon.
	Proximity Ligation Analysis of protein-protein interactions between FGFR2 and FGF5 HeLa cells were stained with anti-FGFR2 rabbit purified polyclonal 1:1200 and anti-FGF5 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).
	Immunoprecipitation of FGF5 transfected lysate using anti-FGF5 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with FGF5 MaxPab rabbit polyclonal antibody.
	Detection limit for recombinant GST tagged FGF5 is 3 ng/ml as a capture antibody.

Storage Recommendations

Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

Expiration:

12 months from the date of shipment when stored properly.

Product Description