3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
Catalog #: 101-10571
Human FOXO3A monoclonal antibody (100 ug)
| Size | 100 µg |
| Estimated Lead Time | 1-2 weeks |
| Species | Human |
| Host Species | Mouse |
| Accession Number | AAH21224 |
| Gene Id | 2309 |
| Gene Symbols | FOXO3A,FOXO3 |
| Protein Name / Synonyms | AF6q21, DKFZp781A0677, FKHRL1, FKHRL1P2, FOXO2, FOXO3A, MGC12739, MGC31925 |
| Clonality | Monoclonal |
| Immunogen Sequence | PCTVELPRLTDMAGTMNLNDGLTENLMDDLLDNITLPPSQ PSPTGGLMQRSSSFPYTTKGSGLGSPTSSFNSTVFGPSSL NSLRQSPMQTIQENKPATFS |
| Isotype | Kappa, IgG2a |
| Recommended Applications | ELISA, Western Blotting, IHC |
| Shipping Type | Blue ice |
| Storage | -20°C |
| More Information | Specificity Human |
![]() | Western Blot detection against Immunogen (36.63 KDa). |
![]() | Immunoperoxidase of monoclonal antibody to FOXO3A on formalin-fixed paraffin-embedded human breast cancer. [antibody concentration 1 ug/ml] |
![]() | Detection limit for recombinant GST tagged FOXO3A is approximately 0.3ng/ml as a capture antibody. |
Your cart is empty.