3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
Catalog #: 101-10580
Human FTL monoclonal antibody (100 ug)
| Size | 100 µg |
| Estimated Lead Time | 1-2 weeks |
| Species | Human |
| Host Species | Mouse |
| Accession Number | AAH04245 |
| Gene Id | 2512 |
| Gene Symbols | FTL |
| Protein Name / Synonyms | MGC71996 |
| Clonality | Monoclonal |
| Immunogen Sequence | MSSQIRQNYSTDVEAAVNSLVNLYLQASYTYLSLGFYFDR DDVALEGVSHFFRELAEEKREGYERLLKMQNQRGGRALFQ DIKKPAEDEWGKTPDAMKAAMALEKKLNQALLDLHALGSA RTDPHLCDFLETHFLDEEVKLIKKMGDHLTNLHRLGGPEA GLGEYLFERLTLKHD |
| Isotype | Kappa, IgG1 |
| Recommended Applications | Immunoprecipitation, ELISA, Western Blotting, Immunofluorescence |
| Shipping Type | Blue ice |
| Storage | -20°C |
| More Information | Specificity Human |
![]() | Western Blot detection against Immunogen (44.99 KDa). |
![]() | Western blot analysis of FTL over-expressed 293 cell line, cotransfected with FTL Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with FTL monoclonal antibody. GAPDH ( 36.1 kDa ) used as specificity and loading control. |
![]() | FTL monoclonal antibody estern Blot analysis of FTL expression in K-562 . |
![]() | Western Blot analysis of FTL expression in transfected 293T cell line by FTL monoclonal antibody Lane 1: FTL transfected lysate(20 KDa). Lane 2: Non-transfected lysate. |
![]() | Immunoprecipitation of FTL transfected lysate using anti-FTL monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with FTL MaxPab rabbit polyclonal antibody. |
![]() | Immunofluorescence of monoclonal antibody to FTL on HeLa cell. [antibody concentration 10 ug/ml] |
![]() | Detection limit for recombinant GST tagged FTL is approximately 0.03ng/ml as a capture antibody. |
Your cart is empty.