3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
Catalog #: 101-10614
Human GCN5L2 monoclonal antibody (100 ug)
| Size | 100 µg |
| Estimated Lead Time | 1-2 weeks |
| Species | Human, Rat |
| Host Species | Mouse |
| Accession Number | AAH32743 |
| Gene Id | 2648 |
| Gene Symbols | GCN5L2,KAT2A |
| Protein Name / Synonyms | GCN5, GCN5L2, MGC102791, PCAF-b, hGCN5 |
| Clonality | Monoclonal |
| Immunogen Sequence | KNLLAQIKSHPSAWPFMEPVKKSEAPDYYEVIRFPIDLKT MTERLRSRYYVTRKLFVADLQRVIANCREYNPPDSEYCRC ASALEKFFYFKLKEGGLIDK |
| Isotype | Kappa, IgG2b |
| Recommended Applications | IHC, ELISA, Western Blotting |
| Shipping Type | Blue ice |
| Storage | -20°C |
| More Information | Specificity Human |
![]() | GCN5L2 monoclonal antibody Western Blot analysis of GCN5L2 expression in human lung cancer. |
![]() | GCN5L2 monoclonal antibody Western Blot analysis of GCN5L2 expression in RIN-m5F. |
![]() | Immunoperoxidase of monoclonal antibody to GCN5L2 on formalin-fixed paraffin-embedded human colon. [antibody concentration 3 ug/ml] |
Your cart is empty.