Loading...
Loading...
Loading...
Loading...
Anti-Glypican-3 (511~560aa) Antibody
| Size | 20 µg, 100 µg, 200 µg |
| Estimated Lead Time | 1-2 business days |
| Species | Human |
| Host Species | Mouse |
| Accession Number | P51654 |
| Gene Id | 2719 |
| Gene Symbols | GPC3 OCI5 |
| Protein Name / Synonyms | Glypican-3 (511~560aa) |
| Clonality | Monoclonal |
| Clone | 8C4-C1-F4 |
| Immunogen | Immunogen was polypeptide Glypican-3 (511~560aa)-KLH:DGMIKVKNQLRFLAELAYDLDVDDAPGNSQQATPKDNEISTFHNLGNVHS. This antibody was produced from a hybridoma resulting from the fusion of a mouse myeloma with B cells obtained from a mouse immunized with the immunogen. The IgG fraction of tissue culture supernatant was purified by Protein G/A affinity chromatography. |
| Immunogen Sequence | KLH:DGMIKVKNQLRFLAELAYDLDVDDAPGNSQQATPKDNEISTFHNLGNVHS |
| Recommended Applications | ELISA (recommended work dilution = 1:80, 000) |
| Reconstitution | Product is supplied as a powder obtained from lyophilization of purified antibody in 1X PBS, aliquot using ddH2O. Reconstitute the antibody with sterile water to a final concentration of 1 mg/ml. |
| Shipping Type | Ambient temperature |
| Storage | -20°C |

10% SDS-PAGE, Goat anti-mouse HRP: 1:5000.
Lane:
M: protein marker
1: HepG2 cell lysate (10 µl)
2: Hela cell lysate (10 µl)
3: Mouse Liver lysate (10 µl)
Anti-Glypican-3 (511~560aa) Antibody