3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
Catalog #: 101-10642
Human GMPPA monoclonal antibody (100 ug)
| Size | 100 µg |
| Estimated Lead Time | 1-2 weeks |
| Species | Human |
| Host Species | Mouse |
| Accession Number | NP_037467 |
| Gene Id | 29926 |
| Gene Symbols | GMPPA |
| Protein Name / Synonyms | None |
| Clonality | Monoclonal |
| Immunogen Sequence | ESIVLHGATLQEHTCVLHSIVGWGSTVGRWARVEGTPSDP NPNDPRARMDSESLFKDGKLLPAITILGCRVRIPAEVLIL NSIVLPHKELSRSFTNQIIL |
| Isotype | Kappa, IgG2a |
| Recommended Applications | Immunoprecipitation, ELISA, Western Blotting |
| Shipping Type | Blue ice |
| Storage | -20°C |
| More Information | Specificity Human |
![]() | Western Blot detection against Immunogen (36.74 KDa). |
![]() | Western Blot analysis of GMPPA expression in transfected 293T cell line by GMPPA monoclonal antibody. Lane 1: GMPPA transfected lysate(46.291 KDa). Lane 2: Non-transfected lysate. |
![]() | Immunoprecipitation of GMPPA transfected lysate using anti-GMPPA monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with GMPPA monoclonal antibody. |
Your cart is empty.