Anti-GNB5 Antibody

Product Description

Size	100 µg
Estimated Lead Time	1-2 weeks
Species	Human
Host Species	Mouse
Accession Number	NP_057278
Gene Id	10681
Gene Symbols	GNB5
Protein Name / Synonyms	FLJ37457, FLJ43714, GB5
Clonality	Monoclonal
Immunogen Sequence	MCDQTFLVNVFGSCDKCFKQRALRPVFKKSQQLSYCSTCA EIMATEGLHENETLASLKSEAESLKGKLEEERAKLHDVEL HQVAERVEAL
Isotype	Kappa, IgG1
Recommended Applications	ELISA, Western Blotting, Proximity Ligation Analysis
Shipping Type	Blue ice
Storage	-20°C
More Information	Specificity Human

FLJ37457, FLJ43714, GB5

Mouse monoclonal antibody raised against a partial recombinant GNB5.

Specificity

Human

Gene Accession #

NM_016194

Storage Buffer

1x PBS, pH 7.2

	Western Blot detection against Immunogen (35.64 KDa).
	Western Blot analysis of GNB5 expression in transfected 293T cell line by GNB5 monoclonal antibody. Lane 1: GNB5 transfected lysate(38.8 KDa). Lane 2: Non-transfected lysate.
	Proximity Ligation Analysis of protein-protein interactions between GNG7 and GNB5. HeLa cells were stained with anti-GNG7 rabbit purified polyclonal 1:1200 and anti-GNB5 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).
	Detection limit for recombinant GST tagged GNB5 is 0.1 ng/ml as a capture antibody.

Storage Recommendations

Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

Expiration:

12 months from the date of shipment when stored properly.

Product Description