3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
Catalog #: 101-10649
Human GOLGA7 monoclonal antibody (100 ug)
| Size | 100 µg |
| Estimated Lead Time | 1-2 weeks |
| Species | Human |
| Host Species | Mouse |
| Accession Number | AAH12032 |
| Gene Id | 51125 |
| Gene Symbols | GOLGA7 |
| Protein Name / Synonyms | GCP16, GOLGA3AP1, GOLGA7A, HSPC041, MGC21096, MGC4876 |
| Clonality | Monoclonal |
| Immunogen Sequence | MRPQQAPVSGKVFIQRDYSSGTRCQFQTKFPAELENRIDR QQFEETVRTLNNLYAEAEKLGGQSYLEGCLACLTAYTIFL CMETHYEKVLKKVSKYIQEQNEKIYAPQGLLLTDPIERGL RVIEITIYEDRGMSSGR |
| Isotype | Kappa, IgG2a |
| Recommended Applications | Immunoprecipitation, ELISA, Western Blotting |
| Shipping Type | Blue ice |
| Storage | -20°C |
| More Information | Specificity Human |
![]() | Western Blot detection against Immunogen (40.81 KDa). |
![]() | GOLGA7 monoclonal antibody Western Blot analysis of GOLGA7 expression in HL-60 . |
![]() | Immunoprecipitation of GOLGA7 transfected lysate using anti-GOLGA7 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with GOLGA7 monoclonal antibody. |
![]() | Detection limit for recombinant GST tagged GOLGA7 is approximately 1ng/ml as a capture antibody. |
Your cart is empty.