3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
Catalog #: 101-10673
Human GTF2IRD1 monoclonal antibody (100 ug)
| Size | 100 µg |
| Estimated Lead Time | 1-2 weeks |
| Species | Human |
| Host Species | Mouse |
| Accession Number | NP_005676 |
| Gene Id | 9569 |
| Gene Symbols | GTF2IRD1 |
| Protein Name / Synonyms | BEN, CREAM1, GTF3, MUSTRD1, RBAP2, WBS, WBSCR11, WBSCR12, hMusTRD1alpha1 |
| Clonality | Monoclonal |
| Immunogen Sequence | IFTGNKFTKDTTKLEPASPPEDTSAEVSRATVLDLAGNAR SDKGSMSEDCGPGTSGELGGLRPIKIEPEDLDIIQVTVPD PSPTSEEMTDSMPGHLPSED |
| Isotype | Kappa, IgG2b |
| Recommended Applications | ELISA, Western Blotting |
| Shipping Type | Blue ice |
| Storage | -20°C |
| More Information | Specificity Human |
![]() | Western Blot detection against Immunogen (36.74 KDa). |
![]() | GTF2IRD1 monoclonal antibody Western Blot analysis of GTF2IRD1 expression in Jurkat . |
![]() | Western Blot analysis of GTF2IRD1 expression in transfected 293T cell line by GTF2IRD1 monoclonal antibody. Lane 1: GTF2IRD1 transfected lysate(106 KDa). Lane 2: Non-transfected lysate. |
Your cart is empty.