3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
Catalog #: 101-10685
Human HAGH monoclonal antibody (200 uL)
| Size | 200 µL |
| Estimated Lead Time | 1-2 weeks |
| Species | Human |
| Host Species | Mouse |
| Accession Number | NP_005317 |
| Gene Id | 3029 |
| Gene Symbols | HAGH |
| Protein Name / Synonyms | GLO2, GLX2, GLXII, HAGH1 |
| Clonality | Monoclonal |
| Immunogen Sequence | GRLPPDTRVYCGHEYTINNLKFARHVEPGNAAIREKLAWA KEKYSIGEPTVPSTLAEEFTYNPFMRVREKTVQQHAGETD PVTTMRAVRREKDQFKMPRD |
| Isotype | Kappa, IgG3 |
| Recommended Applications | Western Blotting, ELISA |
| Shipping Type | Blue ice |
| Storage | -20°C |
| More Information | Specificity Human |
![]() | Western Blot detection against Immunogen (36.74 KDa). |
![]() | HAGH monoclonal antibody Western Blot analysis of HAGH expression in K-562 . |
![]() | Western Blot analysis of HAGH expression in transfected 293T cell line by HAGH monoclonal antibody. Lane 1: HAGH transfected lysate (Predicted MW: 29.9 KDa). Lane 2: Non-transfected lysate. |
Your cart is empty.