3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
Catalog #: 101-10687
Human HAND2 monoclonal antibody (100 ug)
| Size | 100 µg |
| Estimated Lead Time | 1-2 weeks |
| Species | Human |
| Host Species | Mouse |
| Accession Number | NP_068808.1 |
| Gene Id | 9464 |
| Gene Symbols | HAND2 |
| Protein Name / Synonyms | DHAND2, FLJ16260, Hed, MGC125303, MGC125304, Thing2, bHLHa26, dHand |
| Clonality | Monoclonal |
| Immunogen Sequence | LSKIKTLRLATSYIAYLMDLLAKDDQNGEAEAFKAEIKKT DVKEEKRKKELNEILKSTVSSNDKKTKGRTGWPQHVWALE LK |
| Isotype | Kappa, IgG2b |
| Recommended Applications | Immunofluorescence, ELISA, Western Blotting |
| Shipping Type | Blue ice |
| Storage | -20°C |
| More Information | Specificity Human |
![]() | Western Blot detection against Immunogen (34.76 KDa). |
![]() | Western Blot analysis of HAND2 expression in transfected 293T cell line by HAND2 monoclonal antibody. Lane 1: HAND2 transfected lysate(21.6 KDa). Lane 2: Non-transfected lysate. |
![]() | Immunofluorescence of monoclonal antibody to HAND2 on HeLa cell. [antibody concentration 10 ug/ml] |
Your cart is empty.