3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
Catalog #: 101-10716
Human HIP1R monoclonal antibody (200 uL)
| Size | 200 µL |
| Estimated Lead Time | 1-2 weeks |
| Species | Human |
| Host Species | Mouse |
| Accession Number | NP_003950 |
| Gene Id | 9026 |
| Gene Symbols | HIP1R |
| Protein Name / Synonyms | FLJ14000, FLJ27022, HIP12, HIP3, ILWEQ, KIAA0655, MGC47513 |
| Clonality | Monoclonal |
| Immunogen Sequence | SGLSLIKLKKQEMETQVRVLELEKTLEAERMRLGELRKQH YVLAGASGSPGEEVAIRPSTAPRSVTTKKPPLAQKPSVAP RQDHQLDKKDGIYPAQLV |
| Isotype | Kappa, IgG1 |
| Recommended Applications | Western Blotting, ELISA |
| Shipping Type | Blue ice |
| Storage | -20°C |
| More Information | Specificity Human |
![]() | Western Blot detection against Immunogen (36.52 KDa). |
![]() | HIP1R monoclonal antibody. Western Blot analysis of HIP1R expression in human liver. |
![]() | HIP1R monoclonal antibody Western Blot analysis of HIP1R expression in A-431 . |
Your cart is empty.