Anti-HLA-DQA1 Antibody

Product Description

Size	100 µg
Estimated Lead Time	1-2 weeks
Species	Human
Host Species	Mouse
Accession Number	NP_002113.2
Gene Id	3117
Gene Symbols	HLA-DQA1
Protein Name / Synonyms	CD, CELIAC1, DQ-A1, FLJ27088, FLJ27328, GSE, HLA-DQA, MGC149527
Clonality	Monoclonal
Immunogen Sequence	EDIVADHVASCGVNLYQFYGPSGQYTHEFDGDEEFYVDLE RKETAWRWPEFSKFGGFDPQGALRNMAVAKHNLNIMIKRY NSTAATN
Isotype	Kappa, IgG2a
Recommended Applications	ELISA, Proximity Ligation Analysis, Western Blotting
Shipping Type	Blue ice
Storage	-20°C
More Information	Specificity Human

CD, CELIAC1, DQ-A1, FLJ27088, FLJ27328, GSE, HLA-DQA, MGC149527

Mouse monoclonal antibody raised against a partial recombinant HLA-DQA1.

Specificity

Human

Gene Accession #

NM_002122

Storage Buffer

1x PBS, pH 7.2

	Western Blot detection against Immunogen (35.31 KDa).
	Proximity Ligation Analysis of protein-protein interactions between CD74 and HLA-DQA1. HeLa cells were stained with anti-CD74 rabbit purified polyclonal 1:1200 and anti-HLA-DQA1 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).
	Detection limit for recombinant GST tagged HLA-DQA1 is 0.3 ng/ml as a capture antibody.

Storage Recommendations

Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

Expiration:

12 months from the date of shipment when stored properly.

Product Description