3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
Catalog #: 101-10719
Human HLA-DQA1 monoclonal antibody (100 ug)
| Size | 100 µg |
| Estimated Lead Time | 1-2 weeks |
| Species | Human |
| Host Species | Mouse |
| Accession Number | NP_002113.2 |
| Gene Id | 3117 |
| Gene Symbols | HLA-DQA1 |
| Protein Name / Synonyms | CD, CELIAC1, DQ-A1, FLJ27088, FLJ27328, GSE, HLA-DQA, MGC149527 |
| Clonality | Monoclonal |
| Immunogen Sequence | EDIVADHVASCGVNLYQFYGPSGQYTHEFDGDEEFYVDLE RKETAWRWPEFSKFGGFDPQGALRNMAVAKHNLNIMIKRY NSTAATN |
| Isotype | Kappa, IgG2a |
| Recommended Applications | ELISA, Proximity Ligation Analysis, Western Blotting |
| Shipping Type | Blue ice |
| Storage | -20°C |
| More Information | Specificity Human |
![]() | Western Blot detection against Immunogen (35.31 KDa). |
![]() | Proximity Ligation Analysis of protein-protein interactions between CD74 and HLA-DQA1. HeLa cells were stained with anti-CD74 rabbit purified polyclonal 1:1200 and anti-HLA-DQA1 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue). |
![]() | Detection limit for recombinant GST tagged HLA-DQA1 is 0.3 ng/ml as a capture antibody. |
Your cart is empty.