3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
Catalog #: 101-10727
Human HNRNPG-T monoclonal antibody (100 ug)
| Size | 100 µg |
| Estimated Lead Time | 1-2 weeks |
| Species | Human |
| Host Species | Mouse |
| Accession Number | NP_055284 |
| Gene Id | 27288 |
| Gene Symbols | HNRNPG-T,RBMXL2 |
| Protein Name / Synonyms | HNRNPG-T, HNRNPGT, HNRPGT |
| Clonality | Monoclonal |
| Immunogen Sequence | MVEADRPGKLFIGGLNLETDEKALEAEFGKYGRIVEVLLM KDRETNKSRGFAFVTFESPADAKAAARDMNGKSLDGKAIK VAQATKPAFE |
| Isotype | Kappa, IgG1 |
| Recommended Applications | ELISA, Western Blotting, Immunofluorescence, IHC |
| Shipping Type | Blue ice |
| Storage | -20°C |
| More Information | Specificity Human |
![]() | Western Blot detection against Immunogen (35.64 KDa). |
![]() | HNRNPG-T monoclonal antibody Western Blot analysis of HNRNPG-T expression in HeLa . |
![]() | Immunoperoxidase of monoclonal antibody to HNRNPG-T on formalin-fixed paraffin-embedded human testis. [antibody concentration 3 ug/ml] |
![]() | Immunofluorescence of monoclonal antibody to HNRNPG-T on HeLa cell. [antibody concentration 10 ug/ml] |
![]() | Detection limit for recombinant GST tagged HNRNPG-T is approximately 0.1ng/ml as a capture antibody. |
Your cart is empty.