3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
Catalog #: 101-10754
Human HSPA1L monoclonal antibody (100 ug)
| Size | 100 µg |
| Estimated Lead Time | 1-2 weeks |
| Species | Human, Rat |
| Host Species | Mouse |
| Accession Number | NP_005518 |
| Gene Id | 3305 |
| Gene Symbols | HSPA1L |
| Protein Name / Synonyms | HSP70-1L, HSP70-HOM, HSP70T, hum70t |
| Clonality | Monoclonal |
| Immunogen Sequence | KGKISESDKNKILDKCNELLSWLEVNQLAEKDEFDHKRKE LEQMCNPIITKLYQGGCTGPACGTGYVPGRPATGPTIEEV D |
| Isotype | Kappa, IgG1 |
| Recommended Applications | Proximity Ligation Analysis, ELISA, Western Blotting, IHC |
| Shipping Type | Blue ice |
| Storage | -20°C |
| More Information | Specificity Human |
![]() | Western Blot detection against Immunogen (34.65 KDa). |
![]() | HSPA1L monoclonal antibody Western Blot analysis of HSPA1L expression in PC-12 . |
![]() | HSPA1L monoclonal antibody Western Blot analysis of HSPA1L expression in HeLa . |
![]() | Proximity Ligation Analysis of protein-protein interactions between MAP3K7 and HSPA1L HeLa cells were stained with anti-MAP3K7 rabbit purified polyclonal 1:1200 and anti-HSPA1L mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue). |
![]() | Immunoperoxidase of monoclonal antibody to HSPA1L on formalin-fixed paraffin-embedded human testis. [antibody concentration 3 ug/ml] |
![]() | Detection limit for recombinant GST tagged HSPA1L is approximately 0.1ng/ml as a capture antibody. |
Your cart is empty.