3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
Catalog #: 101-10761
Human HSPE1 monoclonal antibody (100 ug)
| Size | 100 µg |
| Estimated Lead Time | 1-2 weeks |
| Species | Human |
| Host Species | Mouse |
| Accession Number | AAH23518 |
| Gene Id | 3336 |
| Gene Symbols | HSPE1 |
| Protein Name / Synonyms | CPN10, GROES, HSP10 |
| Clonality | Monoclonal |
| Immunogen Sequence | MAGQAFRKFLPLFDRVLVERSAAETVTKGGIMLPEKSQGK VLQATVVAVGSGSKGKGGEIQPVSVKVGDKVLLPEYGGTK VVLDDKDYFLFRDGDILGKYVD |
| Isotype | Kappa, IgG1 |
| Recommended Applications | Western Blotting, ELISA, Immunofluorescence |
| Shipping Type | Blue ice |
| Storage | -20°C |
| More Information | Specificity Human |
![]() | Western Blot detection against Immunogen (36.96 KDa). |
![]() | HSPE1 monoclonal antibody -B11 Western Blot analysis of HSPE1 expression in COLO 320 HSR . |
![]() | Western Blot analysis of HSPE1 expression in transfected 293T cell line by HSPE1 monoclonal antibody -B11. Lane 1: HSPE1 transfected lysate(10.9 KDa). Lane 2: Non-transfected lysate. |
![]() | Immunofluorescence of monoclonal antibody to HSPE1 on HeLa cell. [antibody concentration 10 ug/ml] |
![]() | Detection limit for recombinant GST tagged HSPE1 is approximately 0.1ng/ml as a capture antibody. |
Your cart is empty.