3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
Catalog #: 101-10845
Human JMY monoclonal antibody (200 uL)
| Size | 200 µL |
| Estimated Lead Time | 1-2 weeks |
| Species | Human, Mouse |
| Host Species | Mouse |
| Accession Number | NP_689618 |
| Gene Id | 133746 |
| Gene Symbols | JMY |
| Protein Name / Synonyms | FLJ37870, MGC163496 |
| Clonality | Monoclonal |
| Immunogen Sequence | SPMDEVLASLKRGSFHLKKVEQRTLPPFPDEDDSNNILAQ IRKGVKLKKVQKDVLRESFTLLPDTDPLTRSIHEALRRIK EASPESEDEEEALPCTDWEN |
| Isotype | Kappa, IgG2a |
| Recommended Applications | Western Blotting, ELISA |
| Shipping Type | Blue ice |
| Storage | -20°C |
| More Information | Specificity Human |
![]() | Western Blot detection against Immunogen (36.74 KDa). |
![]() | JMY monoclonal antibody Western Blot analysis of JMY expression in MCF-7 . |
![]() | JMY monoclonal antibody Western Blot analysis of JMY expression in Hela NE . |
![]() | JMY monoclonal antibody Western Blot analysis of JMY expression in COLO 320 HSR . |
Your cart is empty.